PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.VU2RD
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 286aa    MW: 31946.1 Da    PI: 4.3365
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.VU2RDgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-172166148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T+eE+e +++++k +G++ W++Ia++++ gRt++++k+ w+++l
      Aradu.VU2RD 21 RGNFTAEEEETIIKLHKAMGNK-WSKIASRLP-GRTDNEIKNVWNTHL 66
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.368115IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.9E-11228IPR009057Homeodomain-like
SuperFamilySSF466891.84E-22274IPR009057Homeodomain-like
PROSITE profilePS5129425.6981670IPR017930Myb domain
SMARTSM007176.8E-162068IPR001005SANT/Myb domain
PfamPF002491.3E-152166IPR001005SANT/Myb domain
CDDcd001678.89E-122366No hitNo description
Gene3DG3DSA:1.10.10.601.3E-232967IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MRCGKSCRLR WINYLRPDVK RGNFTAEEEE TIIKLHKAMG NKWSKIASRL PGRTDNEIKN  60
VWNTHLKKRL TAAKSSDSRE DNANDGSKIE SSVTSPSSSS SESFFSNETP KTNNNNPCNE  120
TNDHISQTDD DDQDSGGKLL QEVIDQQQLV SPTFLNCVAP YDIDVTLEEV DKPNNNNLET  180
KEDCDFWKML DNIESFLSSN EASPPPPPPH QSQTSPTNLN ELGGVVGEAT TKGSNNKAQQ  240
EIIMDPSNDV FDLDLVTRPP EPDQLESELD LGYIQLWPSL PPNTIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1927040108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169279.11e-151PREDICTED: myb-related protein Myb4-like
TrEMBLA0A151R9E52e-61A0A151R9E5_CAJCA; Myb-related protein Zm1
STRINGGLYMA08G17861.18e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100293042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.11e-42myb domain protein 58